<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05244
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MADRHMPSIFPECDQLKQIYDKCFTNFFQKFISPDYSPANNSNPCEQLHESYRKCVEQQLEKTKLYDIDLEELRKEVLDSDNDLIDVTMEASGSSVSGVPIIQDNDGELRFNQLEQTLENFQENARQMGVIASGFTTRSQEPLNQKIHTLTSGLHELDRLKNQFMDVNIPLELLKYLDEGKNPQLYTKECLERTLAKNKEVNGKIECYKKFRTLLLKELGEEMPNDVVMYRNLRDRTETSPNRDMDTSLNN |
Length | 251 |
Position | Middle |
Organism | Syphacia muris |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Oxyuridomorpha> Oxyuroidea> Oxyuridae> Syphacia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.800 |
Instability index | 44.89 |
Isoelectric point | 4.88 |
Molecular weight | 29215.56 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05244
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.39| 15| 16| 181| 195| 1
---------------------------------------------------------------------------
181- 195 (28.45/16.14) KNPQLYTK.ECLE..RTL
197- 214 (18.94/ 8.85) KNKEVNGKiECYKkfRTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.12| 18| 30| 13| 30| 3
---------------------------------------------------------------------------
13- 30 (35.37/20.65) CDQLKQIYDKCFTNFFQK
45- 62 (33.75/19.46) CEQLHESYRKCVEQQLEK
---------------------------------------------------------------------------
|