<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05237
| Description |
Uncharacterized protein |
| Sequence | MALTFWSSSHYKTCLIDPEYGFSSHRLDDIKIIGESQYTKLMIFFANFIQNLGSNVLRSKEKLNMQIIATAIVYFRRFYAKRSVKEIDPFLMAPTCLYLACKAEEFGYLPSDRLVMRANVLLRKYPFLSKDIIINMNLIQEAEFYLLEIMDCSLIVFHPYRSFKTIIKDVIEYFEDSDDENPFANDKEGWNKLFAQTTRVMNDSYRTDLCLKYPPHQIALGCMLIALLNFKKESYFENYFNACLTDKESIENVVSEILSVYDLWENFDEKEELPEIFKKVPRPS |
| Length | 284 |
| Position | Kinase |
| Organism | Parastrongyloides trichosuri (Possum-specific nematode worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Parastrongyloides.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.144 |
| Instability index | 51.06 |
| Isoelectric point | 5.31 |
| Molecular weight | 33442.28 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05237
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.95| 31| 35| 99| 133| 1
---------------------------------------------------------------------------
99- 133 (43.97/40.87) LA.CKAEEFgYLPSdrlVMRANVLL....RKYPFLSKDII
136- 171 (40.98/25.18) MNlIQEAEF.YLLE...IMDCSLIVfhpyRSFKTIIKDVI
---------------------------------------------------------------------------
|