Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MEPSSKENREQCSQELDYVSYSKTCLTQMHTALTELVESFETPNTSNINKKVKLVESRLETFKLSLDQIPGIDNNLSYQEEKIKDLKRCIELKKELINRLYLLPKKLVDVKPGKGVNLSININNIK |
Length | 126 |
Position | Middle |
Organism | Parastrongyloides trichosuri (Possum-specific nematode worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae> Parastrongyloides. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.615 |
Instability index | 42.10 |
Isoelectric point | 8.38 |
Molecular weight | 14528.61 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05231 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 110.68| 37| 39| 39| 77| 1 --------------------------------------------------------------------------- 41- 77 (59.77/45.26) ETPNTSNINKKVKLVE...SRLETFKLSL.DQIPGIDNNLS 79- 119 (50.91/30.87) QEEKIKDLKRCIELKKeliNRLYLLPKKLvDVKPGKGVNLS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LDYVSY 2) VKLVESRL | 16 52 | 21 59 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab