<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05228
| Description |
Uncharacterized protein |
| Sequence | MIDTKFRDELATKRERVELLYSFRGSKIGRGTYGHVYKATPRFETQENKGKIYALKLIEGNGISMSSCREIALLRELSHPNLIKLNRVFLSSERKVWLLFDYAEHDLWHIIKFHRNAKQKKQAVMVPKSMIKSLLFQILDGIHYLHNNWILHRDLKPANILVMGDDPYERGMVKVADMGFARTFHTPVRPLADLDPVVVTFWYRAPELLLGAKHYTKAIDIWAIGCIFAELLTSEPVFFCREEDIKASSPYHKDQLSRIFQVMGFPQDTDWPDLKKMPEYQRLTKDFKKQTFSDCELSKYLEKHKVKTNDRGFNLLQKLLTFDPIKRISSNDALNDIYFKESPKPTLDVFRGGPIPYPRREFMQDENEDKVIGKQQNVQLQQHMVNTIGTNKMFQQQRNNQISGNDIKSNKFQNISITNQIEFNSTNNLNQSLPQQTNTFNNGNHQNIRIQQNQYNPQMIFHGHDPNRVISQHEQSFTQVPIRVSNSQYVNQHQSHVNSQDHSRIMGQQIFSGYDQNRLMIQQQGQNNIIQIHPPNMQQHYIQSNQTASQQQMMQSQNFMWNQQQHYQ |
| Length | 568 |
| Position | Kinase |
| Organism | Parastrongyloides trichosuri (Possum-specific nematode worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Parastrongyloides.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.724 |
| Instability index | 45.57 |
| Isoelectric point | 9.33 |
| Molecular weight | 66699.05 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05228
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
5| 180.69| 35| 35| 448| 482| 1
---------------------------------------------------------------------------
378- 432 (29.09/11.33) VQLQqhmvntigtnkmfQQQRNNQ..ISGNDiksnkfQN..ISIT....NQiefnsTNNLNQS
448- 482 (62.90/32.92) IRIQ.............QNQYNPQMIFHGHD......PNRVISQH....EQ.....SFTQVPI
497- 520 (25.00/ 8.72) VNSQ............dHSRIMGQQIFSGYD......QNRLM.....................
521- 553 (42.08/19.63) ..IQ.............QQGQNN..IIQIHP......PN..MQQHyiqsNQ.....TASQQQM
554- 568 (21.63/ 6.57) MQSQ.............NFMWNQQ...................QH....YQ............
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 119.97| 27| 37| 98| 125| 2
---------------------------------------------------------------------------
73- 97 (38.70/27.46) LLRELSH.....PNL...IKLNRVFLSSERKVW
98- 125 (43.62/38.28) LLFDYAE.....HDLWhIIKFHRNAKQKKQAVM
134- 163 (37.66/26.51) LLFQILDgihylHNNW.IL..HRDLKPANILVM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.14| 23| 39| 191| 217| 3
---------------------------------------------------------------------------
191- 217 (33.50/34.22) LADL...DPVvvtFWYRAPELLlGAKHYTK
228- 253 (37.65/24.54) FAELltsEPV...FFCREEDIK.ASSPYHK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 157.37| 41| 76| 254| 294| 4
---------------------------------------------------------------------------
254- 294 (74.52/45.89) DQLSRIFQVMGF.PQDTDWPDL...KKMP.EYQRLTKD.FKKQTFSD
295- 327 (33.02/16.50) CELSKYLEKHKVkTNDRGFNLL...QKL......LTFDpIKR.....
332- 369 (49.83/28.41) DALNDIY....F..KESPKPTLdvfRGGPiPYPR..RE.FMQDENED
---------------------------------------------------------------------------
|