<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05220

Description Uncharacterized protein
SequenceMCESEIPFRILNIIKYSTNCKPENVHFSIKVRNALEEKELTKKEMQQVCLLIMTSFFKEEKINGKYLNSLESLINLCILSDDIVIATILNMKYEKIVTSKVPYFFVLFKFIDYMVCQKKPKSNNKNDIMKLAEEVLSIFSWFVEILLWSKNESFTKYVLNRTLALINNRYNCILLHSASKKSSECKKILESRAAVLEDKFPNISNYIRENVLTFKISLEPLYTSGLHHDFEAISSLITIYSTIRILTPAKDIAGVVYMMAMNLQLSKVKMVYDMIKGILYNIANNKTRNDAKLILGFATIKFPKILKSLICDIRVVNEVDILITLSKIATETKILRIVDCQCKYNFWEVFITELGRNDIIKESDVKDAINFRKLDYKENEEVYDDVLILKPNYNVQLKESMDAWESLIKLPFDNLPAILTGLKQVIEXGGSVIDGILMTLWFKEEAGNLTRLFSKINYLCQNINSSMDEETKNIRLELFDTTLLILFKFYYYLSDLSIEEFVGINVEDEEKENEEEFFFYFWNTKICKDIDIPDDQIENPFEFNWDAPPKPFTDSTSSDVEVELNDIISDLMNDEERRFKRYVEQDEKKNFQENVEKMDIDVDNTTPEEGEKENIVIKEEEKDNENEPEKNTDSKDIEETLLDGNKEEKDENIQNEGNMDVEEKKDHIRQIVDDLYENKPFWNEESNFIDVVKVIPMITQTLCEDIRKKSHDKGKFLDALWSFKSMPSLLICLFQCLETGNNNQTKLDVLESIQLLFKRGKFEEEPLHNRWHFAYYIIGKMVNDLTKVKAIQEPGAHFIISSFRKTLPVLGYKEIPHIHMVADAMVYTIRHNFVFPESIRIIDHDISIRNDSSWCILCFEEILKLQTPDELDVAASLFLSMAFCRPDICFYEMTKFIVDSALNVQTFYNVTNQPERPSLARLLVRTMCCLIWVIENKKPKEICGSVEHSSERDPGLNLLEIVFSRFYKETLSGHLKPTISFILDFIHELAVSPQTPELSRIYSFISKKLIFNLARLDPSSVTIDLYYRIFNFDDNGEHGLLQFATLHRMKGFL
Length1053
PositionTail
OrganismParastrongyloides trichosuri (Possum-specific nematode worm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae> Parastrongyloides.
Aromaticity0.10
Grand average of hydropathy-0.225
Instability index40.98
Isoelectric point5.08
Molecular weight122773.10
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP05220
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.82|      24|      27|     488|     513|       1
---------------------------------------------------------------------------
  488-  513 (36.39/22.06)	KFYYYLSDLSIEEfvGINVEDEEKEN
  516-  539 (46.43/22.92)	EFFFYFWNTKICK..DIDIPDDQIEN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      91.22|      25|      27|     619|     643|       2
---------------------------------------------------------------------------
  585-  616 (30.25/16.01)	QDEKKNFQENvEKmdidvdNTT...PEEGEKENIV
  619-  643 (42.16/25.44)	EEEKDNENEP.EK......NTD...SKDIEETLLD
  646-  666 (18.81/ 6.95)	KEEKDENIQN.EG......NMDveeKKD.......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.44|      26|      27|     145|     170|       3
---------------------------------------------------------------------------
  145-  170 (44.78/31.31)	ILLW..SKNESFTKYVLNRTLALINNRY
  173-  200 (37.65/25.09)	ILLHsaSKKSSECKKILESRAAVLEDKF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     108.45|      28|      28|     300|     327|       4
---------------------------------------------------------------------------
  255-  282 (30.51/15.36)	.VVYMMAMNLQLSKVKM.VyDMIKGILYNI
  286-  313 (40.83/22.86)	KTRNDAKLILGFATIKF.P.KILKSLICDI
  314-  342 (37.11/20.15)	RVVNEVDILITLSKIATeT.KILRIVDCQC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.17|      17|      28|     857|     873|       5
---------------------------------------------------------------------------
  857-  873 (29.67/18.48)	LCFEEILKLQTPDELDV
  888-  904 (30.50/19.21)	ICFYEMTKFIVDSALNV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.47|      24|      28|     670|     696|       6
---------------------------------------------------------------------------
  670-  696 (34.46/28.53)	Q.IVDDLYENKpfwNEESNFIDVV...KVIP
  700-  727 (32.01/16.44)	QtLCEDIRKKS...HDKGKFLDALwsfKSMP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP05220 with Med24 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) QENVEKMDIDVDNTTPEEGEKENIVIKEEEKDNENEPEKNTDSKDIEETLLDGNKEEKDENIQNEGNMDVEEK
592
664










Molecular Recognition Features






MoRF SequenceStartStop




1) VFRFR
91
95