<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05218
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MNLPNQQFNQQTFNPSTPMSQSEIQQQGSIKQQPTPQQQQQTTMPKINSLIHQAPPQQPIEAEYTLSTRLANIDVVEQKISELIKYTRICLQELSKDKQITKNKMEDASQNFRKCLNAIDSDLSEQLEYLSRVCVGVDHQGSTFSTEANIRIAKESEDIIGRELMNVYNEYFGDSESH |
| Length | 178 |
| Position | Head |
| Organism | Parastrongyloides trichosuri (Possum-specific nematode worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Parastrongyloides.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.811 |
| Instability index | 68.48 |
| Isoelectric point | 4.98 |
| Molecular weight | 20366.49 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05218
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.82| 17| 17| 21| 37| 1
---------------------------------------------------------------------------
21- 37 (31.77/16.04) QSE..IQQQGSIKQQPTPQ
39- 57 (25.05/11.32) QQQttMPKINSLIHQAPPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.78| 10| 23| 88| 97| 2
---------------------------------------------------------------------------
88- 97 (17.75/12.99) RICLQELSKD
113- 122 (18.03/13.29) RKCLNAIDSD
---------------------------------------------------------------------------
|