<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05217
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MNMDSTFRHQGSQDYIDSERKRFEAECEFVQALGNPHYCNFLAQKGYFKEDYFINYLKYLQYFKQPEYAKTIVYPHCLFMLECLQHKEFRDAISNINNAKYIENQQMLQWQYYYRKRNEYNAKIMHAKTVGELKTTEDVVNLLKELGSEVQDSNHPNNEEREANVEDEXXXXNTNTLNNDDETQSQKEIMRLLKELREGMKITEEGKVILDEKMEEEDDDESEEVSPEIQELLDEIEQETSDALSKAFSEEEDAEIEDYEQDVKPAPYGQNEDYETFVREQEHKRIEIAFDQVAEYGEITEEELARSGYSTDILFDSNIISLAMKSKEKQEEPR |
| Length | 334 |
| Position | Middle |
| Organism | Parastrongyloides trichosuri (Possum-specific nematode worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Parastrongyloides.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -1.048 |
| Instability index | 69.70 |
| Isoelectric point | 4.44 |
| Molecular weight | 39134.51 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05217
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.75| 20| 20| 234| 253| 1
---------------------------------------------------------------------------
201- 219 (23.90/10.30) .KITEEGKVILDEKMEEEDD
234- 253 (31.13/15.35) DEIEQETSDALSKAFSEEED
257- 273 (28.71/13.66) EDYEQDVKPA...PYGQNED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 89.60| 22| 37| 28| 50| 2
---------------------------------------------------------------------------
11- 25 (15.55/ 6.12) .....GSQDYID..SERKRFEA
29- 50 (42.28/31.14) FVQALGNPHYCNFLAQKGYFKE
53- 71 (31.77/16.76) FINYL...KYLQYFKQPEYAKT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.51| 16| 20| 152| 168| 3
---------------------------------------------------------------------------
152- 168 (22.95/17.41) DSNHPNNEErEANVEDE
173- 188 (26.56/15.40) NTNTLNNDD.ETQSQKE
---------------------------------------------------------------------------
|