<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05217

Description Mediator of RNA polymerase II transcription subunit 31
SequenceMNMDSTFRHQGSQDYIDSERKRFEAECEFVQALGNPHYCNFLAQKGYFKEDYFINYLKYLQYFKQPEYAKTIVYPHCLFMLECLQHKEFRDAISNINNAKYIENQQMLQWQYYYRKRNEYNAKIMHAKTVGELKTTEDVVNLLKELGSEVQDSNHPNNEEREANVEDEXXXXNTNTLNNDDETQSQKEIMRLLKELREGMKITEEGKVILDEKMEEEDDDESEEVSPEIQELLDEIEQETSDALSKAFSEEEDAEIEDYEQDVKPAPYGQNEDYETFVREQEHKRIEIAFDQVAEYGEITEEELARSGYSTDILFDSNIISLAMKSKEKQEEPR
Length334
PositionMiddle
OrganismParastrongyloides trichosuri (Possum-specific nematode worm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae> Parastrongyloides.
Aromaticity0.10
Grand average of hydropathy-1.048
Instability index69.70
Isoelectric point4.44
Molecular weight39134.51
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP05217
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      83.75|      20|      20|     234|     253|       1
---------------------------------------------------------------------------
  201-  219 (23.90/10.30)	.KITEEGKVILDEKMEEEDD
  234-  253 (31.13/15.35)	DEIEQETSDALSKAFSEEED
  257-  273 (28.71/13.66)	EDYEQDVKPA...PYGQNED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      89.60|      22|      37|      28|      50|       2
---------------------------------------------------------------------------
   11-   25 (15.55/ 6.12)	.....GSQDYID..SERKRFEA
   29-   50 (42.28/31.14)	FVQALGNPHYCNFLAQKGYFKE
   53-   71 (31.77/16.76)	FINYL...KYLQYFKQPEYAKT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.51|      16|      20|     152|     168|       3
---------------------------------------------------------------------------
  152-  168 (22.95/17.41)	DSNHPNNEErEANVEDE
  173-  188 (26.56/15.40)	NTNTLNNDD.ETQSQKE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP05217 with Med31 domain of Kingdom Metazoa

Unable to open file!