<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05210
Description |
Uncharacterized protein |
Sequence | MEESSQAFKKTLTQVEKELSEQMLYLSNVXVCVGSAHQGSTFASQQNISLAEAAEMDLHRELANITEKHFGETDI |
Length | 75 |
Position | Head |
Organism | Nippostrongylus brasiliensis (Rat hookworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Trichostrongyloidea> Heligmonellidae> Nippostrongylinae> Nippostrongylus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.399 |
Instability index | 38.83 |
Isoelectric point | 4.68 |
Molecular weight | 8231.07 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05210
No repeats found
No repeats found
|