<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05206
| Description |
Uncharacterized protein |
| Sequence | MTVNAQRQPPLLRLSKRHLESGRRVQVVVGPWSLHAVLLPLGTEVGRNQPNAEKQWEEWKEFVAPLVRDVDEAEEENQEDGIPRMVPVEIDGIRMLYPSCYVCVPMEDDAACSKDDPVAPPMTPDELITPDNGRRNQLLVSNANGHSYMQGVLQNAYLAP |
| Length | 160 |
| Position | Middle |
| Organism | Nippostrongylus brasiliensis (Rat hookworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Trichostrongyloidea> Heligmonellidae> Nippostrongylinae> Nippostrongylus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.496 |
| Instability index | 52.77 |
| Isoelectric point | 4.77 |
| Molecular weight | 17952.16 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05206
No repeats found
|