<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05204

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMPPRHPQGQPQGQPPPSSGQSTVLEALINQPQYPSAPQMGPGGHMGGPMDSQHDQQQVYNQKLRMLRPYCENLKLRAQQCRMEGNMEAAQKLETMLGVLEGRRVVSLEYLLNLENWIHKKADFLAATTHNPHAAAMQNGHMGMTGQGMVDGINANKPSVPEAARRELSQLSDRFEFDNNSEPHHDPHSALVKCKINAFFYDDLQNVVHERLARPGLHSVTEFLNTWESTVRQYTSNQNNANTTISPFEDLFQNYDNIIT
Length259
PositionTail
OrganismNippostrongylus brasiliensis (Rat hookworm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida> Trichostrongyloidea> Heligmonellidae> Nippostrongylinae> Nippostrongylus.
Aromaticity0.07
Grand average of hydropathy-0.757
Instability index46.42
Isoelectric point6.04
Molecular weight29152.32
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats
>MDP05204
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.79|      18|      93|      34|      52|       1
---------------------------------------------------------------------------
    3-   20 (38.46/22.87)	PRHPQGQPQGQ.PPPSSGQ
   34-   52 (33.33/24.08)	PSAPQMGPGGHmGGPMDSQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP05204 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MPPRHPQGQPQGQPPPSSGQSTVLEALINQPQYPSAPQMGPGGHMGGPMDSQHDQQQVYNQKL
2) TTHNPHAAAMQNGHMGMTGQGMVDGINANKPSVPEAAR
1
127
63
164










Molecular Recognition Features






MoRF SequenceStartStop




NANANA