<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05196

Description Putative transcription elongation factor S-II (inferred by orthology to a C. elegans protein)
SequenceMTINDLRKKTSDEKLAKKAKNLIKEWKNLVDKREDKKEKAPKSEPSSSNSSKSNGSNQASKAPSTPAPTPAPSQHYSSNFPPKHLENDEVRLKSAQLILNALRYAELPVGTLDPEDIAVKVEEKLYTVHKGTGDKYKAALRSRVFNLRDKKNPALRENVLTGVVKPEKFAIMTSEEMASDEVREMRDKFNKAAILEHQMSVQQGTPSDMFKCGKCGKKNCTYTQLQTRSSDEPMTTFVFCLECGNRWKFC
Length250
PositionUnknown
OrganismNippostrongylus brasiliensis (Rat hookworm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida> Trichostrongyloidea> Heligmonellidae> Nippostrongylinae> Nippostrongylus.
Aromaticity0.06
Grand average of hydropathy-0.874
Instability index47.89
Isoelectric point9.34
Molecular weight28187.88
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:InterPro

GO - Biological Function
nucleic acid binding	GO:0003676	IEA:InterPro
zinc ion binding	GO:0008270	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro
transcription, DNA-templated	GO:0006351	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP05196
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.64|      19|      19|      39|      57|       1
---------------------------------------------------------------------------
   36-   54 (30.98/16.39)	KKEKA......PKSEPSSSNSSKSN
   55-   79 (28.66/14.70)	GSNQAskapstPAPTPAPSQHYSSN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.62|      13|      25|     206|     218|       2
---------------------------------------------------------------------------
  206-  218 (27.15/17.60)	PSDMFK.CGKCGKK
  233-  246 (22.47/13.54)	PMTTFVfCLECGNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.81|      11|      18|     110|     120|       3
---------------------------------------------------------------------------
  110-  120 (18.81/13.76)	GTLDPEDIAVK
  131-  141 (19.00/13.95)	GTGDKYKAALR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP05196 with Med26 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MTINDLRKKTSDEKLAKKAKNLIKEWKNLVDKREDKKEKAPKSEPSSSNSSKSNGSNQASKAPSTPAPTPAPSQHYSSNFPPKHLENDE
1
89










Molecular Recognition Features






MoRF SequenceStartStop




1) DEKLAKKAKNLIKEWKNLVDKREDKKEK
12
39