<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05196
| Description |
Putative transcription elongation factor S-II (inferred by orthology to a C. elegans protein) |
| Sequence | MTINDLRKKTSDEKLAKKAKNLIKEWKNLVDKREDKKEKAPKSEPSSSNSSKSNGSNQASKAPSTPAPTPAPSQHYSSNFPPKHLENDEVRLKSAQLILNALRYAELPVGTLDPEDIAVKVEEKLYTVHKGTGDKYKAALRSRVFNLRDKKNPALRENVLTGVVKPEKFAIMTSEEMASDEVREMRDKFNKAAILEHQMSVQQGTPSDMFKCGKCGKKNCTYTQLQTRSSDEPMTTFVFCLECGNRWKFC |
| Length | 250 |
| Position | Unknown |
| Organism | Nippostrongylus brasiliensis (Rat hookworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Trichostrongyloidea> Heligmonellidae> Nippostrongylinae> Nippostrongylus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.874 |
| Instability index | 47.89 |
| Isoelectric point | 9.34 |
| Molecular weight | 28187.88 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:InterPro
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05196
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.64| 19| 19| 39| 57| 1
---------------------------------------------------------------------------
36- 54 (30.98/16.39) KKEKA......PKSEPSSSNSSKSN
55- 79 (28.66/14.70) GSNQAskapstPAPTPAPSQHYSSN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.62| 13| 25| 206| 218| 2
---------------------------------------------------------------------------
206- 218 (27.15/17.60) PSDMFK.CGKCGKK
233- 246 (22.47/13.54) PMTTFVfCLECGNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.81| 11| 18| 110| 120| 3
---------------------------------------------------------------------------
110- 120 (18.81/13.76) GTLDPEDIAVK
131- 141 (19.00/13.95) GTGDKYKAALR
---------------------------------------------------------------------------
|