<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05192
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSLLNLSKRQPDLLLNPATDDGIFKQTPAATRIDLEAPRNTAVAVPHELVSEGSRACSTVVDYVNAQRMLAGTAHTEQLLLELNSAAHINRGPEGVFESSRLHWDMLLGRDERIFPSDYLNFDSKMKMYGCNTPAVTPIYKYALVMRPNPLHITFKNPNWPANFITPENVLEYFCNSDNAFYDKGSCNENVRMQNISRPLEECLLTMTVTPLAYYYIINGTVYQAPDVYTFVQSRLLGAVEPLKNAFDQVIQFSRYNVAKGYYWQFDKKPAVKKEDEKSEEEKPLQVRSTHFQKTRTHMLMQNLFEMYPAGDTVAISDPPDKSEPMDSEEKSEMIDDGAAETVGEDVTASITTAKPK |
Length | 357 |
Position | Head |
Organism | Nippostrongylus brasiliensis (Rat hookworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Trichostrongyloidea> Heligmonellidae> Nippostrongylinae> Nippostrongylus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.465 |
Instability index | 42.66 |
Isoelectric point | 5.15 |
Molecular weight | 40374.25 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05192
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.79| 17| 43| 115| 132| 1
---------------------------------------------------------------------------
115- 132 (28.88/22.78) FPSDYLNFDSKMKmYGCN
160- 176 (33.91/21.44) WPANFITPENVLE.YFCN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 108.17| 33| 280| 23| 66| 2
---------------------------------------------------------------------------
23- 55 (53.98/56.11) IFKQTPAATRIDLEAPRNTAVAVPHELVSEGSR
69- 101 (54.20/31.74) MLAGTAHTEQLLLELNSAAHINRGPEGVFESSR
---------------------------------------------------------------------------
|