<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05176
Description |
Cyclin-C (inferred by orthology to a C. elegans protein) |
Sequence | MAGNFWQSSHYDQWIFEKQELLRMRSEDLKIYTEEEYQKLMIFWANLIQTLAVEGIQQGHPKTRMQVIATAIVYFKRFYARRSYKDVDPLLIACASVFLASKVEEHGLMSMSNLIKTIPNCLKKWPNLTYDASSKNSGLYDAEFILVEMLDCCLVVYHPYRPLTTMLQVNHTKISNDIARDPSVKDIVPFEEQCWKVANDSLRSDCSLLYPPHIIAISSIIVGAELMNREKDIKTWLPELSVDFEKVYDCVNTIFAMYKTWKTFDEKEHVKPLFDKLPKINPGPTF |
Length | 286 |
Position | Kinase |
Organism | Nippostrongylus brasiliensis (Rat hookworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Trichostrongyloidea> Heligmonellidae> Nippostrongylinae> Nippostrongylus.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.197 |
Instability index | 43.71 |
Isoelectric point | 6.19 |
Molecular weight | 33312.26 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05176
No repeats found
|