<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05175
| Description |
Uncharacterized protein |
| Sequence | MLKTLEDHFAKRPNNETRLRNVRITSIVPVDVREIVVEIKMGAPQDVQFVPHMKLVLVFLNSELALIRIGAPKEKLWSKDSDSESKYEVFRKISRVVACIVLAKHNLKKIPTESLFISIVSFIQRFTKCFYSKCAVCRKTMRDFLPPIVIKPYRLDTVFIHEDCALDSSEYEG |
| Length | 173 |
| Position | Tail |
| Organism | Haemonchus placei (Barber's pole worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Trichostrongyloidea> Haemonchidae> Haemonchus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.029 |
| Instability index | 37.79 |
| Isoelectric point | 9.22 |
| Molecular weight | 20015.38 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05175
No repeats found
|