<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05167

Description Uncharacterized protein
SequenceMPSCEDEVLAIGRKLDKIIDGTKPGDNAADLLEVLSKLPITIDVLTKTRIGMTINDLRKKTTDEKLAKKAKSLIKEWKNLVDKREDKKEKAAKNEPSSSNSGKNNGSVSDQPTPKIAQPSTQPPAPIPGHHYSSNFPPKHLEADEVRLKSAQMILNALRYAELPVGTLDPEEIAVKVEEKLFSVHKGTGDKYKAALRSRVFNLRDKKNPALRENVLTGVVKPEKFAVMTSEEMASDEVREMRDKFNKAAILEHQMSVQQGTPSDMFKCGKCGKKNCTYTQLQTRSSDEPMTTFVFCLECGNRWKFC
Length306
PositionUnknown
OrganismHaemonchus placei (Barber's pole worm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida> Trichostrongyloidea> Haemonchidae> Haemonchus.
Aromaticity0.05
Grand average of hydropathy-0.681
Instability index41.33
Isoelectric point9.05
Molecular weight34190.94
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
nucleic acid binding	GO:0003676	IEA:InterPro
zinc ion binding	GO:0008270	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro
transcription, DNA-templated	GO:0006351	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP05167
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     110.44|      25|      25|      90|     114|       1
---------------------------------------------------------------------------
   65-   89 (34.92/19.26)	KLAK..KAKSLIKEWKNLVDKREDKKE
   90-  114 (41.06/23.78)	KAAK..NEPSSSNSGKNNGSVSDQPTP
  115-  138 (34.46/18.92)	KIAQpsTQPPAPIPGHHYS..SNFP.P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     124.09|      39|      51|     157|     196|       2
---------------------------------------------------------------------------
  157-  192 (49.00/32.53)	.................ALRYAELpVGTLDPEEIAVKVE.EKLFSVH.KGT.GDKY
  193-  245 (51.49/29.43)	KAALrsrvfnlrdkknpALRENVL.TGVVKPEKFAVMTS.EEMASDEvREM.RDKF
  247-  266 (23.60/10.36)	KAAI...................................lEHQMSVQ.QGTpSDMF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.66|      23|      24|       9|      31|       4
---------------------------------------------------------------------------
    9-   31 (38.66/26.40)	LAIGRKLDKIID...GTKPGDNAADL
   32-   57 (33.01/21.58)	LEVLSKLPITIDvltKTRIGMTINDL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP05167 with Med26 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KREDKKEKAAKNEPSSSNSGKNNGSVSDQPTPKIAQPSTQPPAPIPGHHYSSNFPPKHLEADE
83
145










Molecular Recognition Features






MoRF SequenceStartStop




1) LIKEWKNL
73
80