<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05165
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MGERRMASIFPECDQLKQNYDKCFTEFFQKFIGSNYRHKYATNPCDRLHQAYRECVEERLATAKPFEIDISEIEKKFLNTEDDKLRDSQEGKYLQSNLPHPQIISDSGESRFNQLERTLEQFQFMISEQVYAFLQENARHLGVIATDFGARSQEPFNQKIHTLISGLQELDQMRSQFMDVKVPLELLDVLDQGKNPQLYTKEVLERTLQKNKELTSFRPMSIWANPVFRPQNGVSAALIRFVPHFVGLRLSWTQNSLRSEGIEQFVEEYLPIIRENNPQIQYFLHRTYTECDPFVVGEYKFHRYRKKRVSWRSKHQVLSMVEEMAIGGDYRPGLKRGVNRRLPRGLELWDTETMGHDVFKVHSKWKADEEDMEMPTSQKHPNFVYRKY |
Length | 388 |
Position | Middle |
Organism | Haemonchus placei (Barber's pole worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Trichostrongyloidea> Haemonchidae> Haemonchus.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.743 |
Instability index | 51.81 |
Isoelectric point | 7.20 |
Molecular weight | 45997.68 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05165
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.68| 15| 16| 76| 90| 1
---------------------------------------------------------------------------
76- 90 (25.24/16.66) KFLNT...EDDKLRDSQE
92- 109 (21.43/13.17) KYLQSnlpHPQIISDSGE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.98| 25| 276| 10| 39| 2
---------------------------------------------------------------------------
10- 36 (40.35/27.28) FPECDQLK.QNYdKcFTEFFQKF.................IGSNY
288- 330 (35.63/14.53) YTECDPFVvGEY.K.FHRYRKKRvswrskhqvlsmveemaIGGDY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.02| 18| 21| 231| 248| 5
---------------------------------------------------------------------------
231- 248 (30.83/16.31) QNGV.SAALIRFVPHFVGL
254- 272 (26.20/13.07) QNSLrSEGIEQFVEEYLPI
---------------------------------------------------------------------------
|