<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05160
| Description |
Uncharacterized protein |
| Sequence | MIDYAFKQELARSRENVDDLFYYDGHKVGRGTYGHVFKAQPKVPSAKYPAKEYALKLIEGQGFSMSACREIALLRELKHPNLICLQRVFLTNEKKVWLLLDYAEHDLWHIIKYHRGAKAKKMPVMVPKGMVKSILYQILDGIHYLHSNWVLHRDLKPANILVMGDAPGVHRGRVKIADMGFARIFYNPLKPLAELDPVVVTFWYRAPELLLGAKHYTKAIDVWAIGCIFAELLTAEPVFFCKEEDIKAQSPYHYDQLKRIFTVMGYPQESEWTDFKKMPDYHKLQTDIKSSQTAFPNCSMTRYMEKHKIESDSPQFKLLVKLLTMDPNKRISCKEAMEEPYFKMDPKPTEDVFYKFEIPYPKHADIKKSLAMNIVDDQNQQATNPQVNQAMNQQLDSEPVNKRLRMGGQQVDLVLWSF |
| Length | 418 |
| Position | Kinase |
| Organism | Haemonchus placei (Barber's pole worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Trichostrongyloidea> Haemonchidae> Haemonchus.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.406 |
| Instability index | 55.23 |
| Isoelectric point | 8.88 |
| Molecular weight | 48612.97 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05160
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.59| 19| 89| 231| 252| 2
---------------------------------------------------------------------------
231- 252 (30.74/27.56) ELLTAEP..VFFCKEEdikAQSPY
321- 341 (31.85/19.83) KLLTMDPnkRISCKEA...MEEPY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.33| 27| 36| 122| 157| 3
---------------------------------------------------------------------------
122- 157 (40.58/53.30) MPVM.....VPKGMVKsilyqILDgihyLHSNWVLHRDLKP
160- 191 (41.75/28.63) ILVMgdapgVHRGRVK.....IAD....MGFARIFYNPLKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 29.34| 9| 23| 282| 292| 4
---------------------------------------------------------------------------
282- 292 (11.91/15.38) HKLQTDikSSQ
307- 315 (17.42/12.57) HKIESD..SPQ
---------------------------------------------------------------------------
|