<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05154
Description |
Uncharacterized protein |
Sequence | HSVRESEAHPVNSEVVIRLAHQISKNYSVSAPLYWQQVLIKTSTKR |
Length | 46 |
Position | Middle |
Organism | Haemonchus placei (Barber's pole worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Trichostrongyloidea> Haemonchidae> Haemonchus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.457 |
Instability index | 31.93 |
Isoelectric point | 9.82 |
Molecular weight | 5287.94 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05154
No repeats found
No repeats found
|