<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05153
| Description |
Uncharacterized protein |
| Sequence | MGRVSSPMTGIPQIPMQGKVWSPRTGYQQASPSPRGRGGTQWAGRSGAPGGVSPFQKRAGHIGENSPRMVSPTVNINFVSPPPRMNPPPVNKVEQMSSDSSSSSSSEDESPK |
| Length | 112 |
| Position | Middle |
| Organism | Haemonchus placei (Barber's pole worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Trichostrongyloidea> Haemonchidae> Haemonchus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.860 |
| Instability index | 89.58 |
| Isoelectric point | 10.89 |
| Molecular weight | 11817.07 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05153
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.40| 14| 15| 62| 75| 1
---------------------------------------------------------------------------
62- 75 (26.95/10.14) IGENSPRMVSPTVN
78- 91 (29.44/11.67) FVSPPPRMNPPPVN
---------------------------------------------------------------------------
|