Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MDELRELYSVENDVPIVAKLEPSVDCYQTQVSFKELVLYGSVFKKNKDELIQRLRGLCDPGSVEFSEHEMVFSLRTGQDPDVTIRLRRKFGSDANSYLWHFRYIGSPEPDNLCSTIVRKSISSLVFSHNMMEFVKTLGLRMDYEYIAKGQLFTKGSIKILISNITKTEKTGNYEPNVLKPLSDSLLVEMSCALPETVGYQHTAKVMRDVADQLLPICNMQKVEYWKRPMP |
Length | 230 |
Position | Head |
Organism | Enterobius vermicularis (Human pinworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Oxyuridomorpha> Oxyuroidea> Oxyuridae> Enterobius. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.300 |
Instability index | 30.91 |
Isoelectric point | 6.45 |
Molecular weight | 26418.22 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05151 No repeats found No repeats found |
IDR Sequence | Start | Stop |
NA | NA | NA |
MoRF Sequence | Start | Stop |
1) IRLRRKF 2) NSYLWHFRYIG | 84 95 | 90 105 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab