<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05140
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MSQTTVGPYGHQQDPEKIIQATAHIEDKAAEIKKTIEQLIFMLDLQDKVPWPEMLDKFSSLASAMTQLQSMLKKSALPSGAEDYGLLLRTHLLVPHLLSMDIDPALQEQTEKRLHFWNHDVCPDYLRTKLTPELENEEAQFENERNVRGADAIHKQITTMNKHVETLLASLADTSRGQNDIRADAPAYNDRDTQTLVRAVVNGESLRPTRIGPVEATQSTAASSSSTSTSANSRTSGASPTMQRR |
| Length | 245 |
| Position | Head |
| Organism | Enterobius vermicularis (Human pinworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Oxyuridomorpha> Oxyuroidea> Oxyuridae> Enterobius.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.593 |
| Instability index | 50.52 |
| Isoelectric point | 5.62 |
| Molecular weight | 27248.29 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05140
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.64| 25| 26| 86| 111| 1
---------------------------------------------------------------------------
86- 111 (37.71/27.00) LLLRTHLLVPHLLSMDIDPALqEQTE
114- 138 (44.93/27.91) LHFWNHDVCPDYLRTKLTPEL.ENEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.48| 23| 27| 27| 52| 2
---------------------------------------------------------------------------
27- 52 (35.49/35.43) DKAAEIKKTIEQLIFMLdlqDKVPWP
56- 78 (37.99/28.08) DKFSSLASAMTQLQSML...KKSALP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.69| 20| 27| 148| 167| 3
---------------------------------------------------------------------------
148- 167 (34.13/20.06) RGADAIHKQITTMN.KHVETL
176- 196 (30.56/17.40) RGQNDIRADAPAYNdRDTQTL
---------------------------------------------------------------------------
|