<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05136
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MADRHMPSIFPECDQLKQVYDKCFTSFFQKFISPEYSHLSNTNPCEQLHESYRKCVEQHLEKNKLYDIDLEELRKEVLNTEHDRLKAQQEKRMDISGSSGPGVPIIQDSDAESRFNQLEQTLENFQENARQMGVIASDFTTRSQDPLNQRIHTLTSGLHELDRLKNQFMDVNIPLELLKYLDDGKNPQLYTKECLERTLAKNKEVNGKIECYKKFRTLLLKELGEEMPNDAVMYRSLRDRTGNSPARDVDTSLSG |
| Length | 255 |
| Position | Middle |
| Organism | Enterobius vermicularis (Human pinworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Oxyuridomorpha> Oxyuroidea> Oxyuridae> Enterobius.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.860 |
| Instability index | 45.62 |
| Isoelectric point | 5.48 |
| Molecular weight | 29668.06 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05136
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.91| 15| 74| 40| 58| 1
---------------------------------------------------------------------------
11- 26 (26.23/14.31) PeCDQLKQVYDKCFTS
44- 58 (30.67/15.05) P.CEQLHESYRKCVEQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.35| 12| 77| 81| 95| 3
---------------------------------------------------------------------------
81- 95 (18.26/18.11) EHDRLKAQqekRMDI
160- 171 (23.09/13.53) ELDRLKNQ...FMDV
---------------------------------------------------------------------------
|