<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05130
| Description |
Uncharacterized protein |
| Sequence | LKINFSVEKGNNSDTAVKLRHLEASLEQLKDSIESIVDISRDENYQSAKIASLKSQLQLKDSLITSFKKDGCPSDQVKEKRTKLVCVRCKCVIIDSNSTKFTNDKPFDLPKCEMKNSVDIEKEMIMHWYIVESLFEFDNIGVTNPDGGVKYLACSECEYGPIGFYCNDALHYYLAAERICLSNC |
| Length | 184 |
| Position | Middle |
| Organism | Dracunculus medinensis (Guinea worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Dracunculoidea> Dracunculidae> Dracunculus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.353 |
| Instability index | 38.89 |
| Isoelectric point | 5.47 |
| Molecular weight | 20856.63 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | guanyl-nucleotide exchange factor activity GO:0005085 IEA:UniProtKB-KW
transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | protein transport GO:0015031 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
small GTPase mediated signal transduction GO:0007264 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05130
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.87| 21| 25| 133| 157| 1
---------------------------------------------------------------------------
137- 157 (41.68/24.92) FDNIGVTNPDGGVKYLA....C.SEC
159- 184 (35.19/13.18) YGPIGFYCNDALHYYLAaeriClSNC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.46| 23| 29| 9| 36| 2
---------------------------------------------------------------------------
9- 33 (30.03/32.78) KGNNSDTAvKLRHLEASLeQLKDSI
41- 63 (38.44/21.52) RDENYQSA.KIASLKSQL.QLKDSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.61| 10| 31| 65| 75| 3
---------------------------------------------------------------------------
65- 75 (14.81/12.34) TSFKKDGcPSD
99- 108 (19.80/10.28) TKFTNDK.PFD
---------------------------------------------------------------------------
|