<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05128
| Description |
Uncharacterized protein |
| Sequence | MSIRMSQPQQIAQQFHSLSNSSEHCLNAIRLLRNEVVKANRKISGNSLGELDASNLKRKSLENHAKNLPSSTPLTVQLERLNRLISDGHIDPYINELYDRLQDASSWMETDSVS |
| Length | 114 |
| Position | Tail |
| Organism | Dracunculus medinensis (Guinea worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Dracunculoidea> Dracunculidae> Dracunculus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.640 |
| Instability index | 52.64 |
| Isoelectric point | 6.90 |
| Molecular weight | 12901.33 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05128
No repeats found
No repeats found
|