<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05124
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MNGTAASLNQKHEGLERFARNDAPSIIFGHQQDITRFNQAVSHIEMKAVEIKNNIEQLLFMLDLQEKVSWPDMLDKFSSLASAMTQLQSMLKKSALPSGTEDYGNLLRTHLLVPHRLSNEIDANLQAMTTNRLHCWNHDAAPEYLRTKLTPEIEADEAHIDTEKNARTFDQVNKQILAMNKHIETLLTSIIENAKSQADAHIDTPTYDNQDTQKLVRAIVNGEGLRPSRSSANVQSDTSHLGTASNSASSTHVANRQPMGMVPQQRR |
Length | 267 |
Position | Head |
Organism | Dracunculus medinensis (Guinea worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Dracunculoidea> Dracunculidae> Dracunculus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.606 |
Instability index | 56.77 |
Isoelectric point | 6.17 |
Molecular weight | 29901.22 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP05124
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.27| 34| 36| 87| 122| 1
---------------------------------------------------------------------------
87- 122 (51.17/55.34) LQSMlKKSALPSGTEDYG.NLLRTHlLVPHRLSNE..ID
125- 161 (53.10/45.36) LQAM.TTNRLHCWNHDAApEYLRTK.LTPEIEADEahID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.12| 20| 36| 194| 213| 2
---------------------------------------------------------------------------
194- 213 (35.30/17.97) AKSQAD.AHIDTPTYDNQDTQ
232- 252 (28.82/13.73) ANVQSDtSHLGTASNSASSTH
---------------------------------------------------------------------------
|