Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MDISTGGVASSGSLRTKISLKGGYSQSSLVCPFHLMKPELPQQSVLLGSHDLLAEYDMSAAYHRFCGAKKMREDLASFLPHLVGNFNFDSSLEFSSLRMLVEKPPITGKEITSLSSSAMAGFRLTPGAVPEPYRFFDKRMDDLNNSNGNDDIDEEGKLVKRFKRSFEDLDDVDSDRKYKKHKGDDSYKKQKKKKKDKKKKKDGKDEDLSKKSKKL |
Length | 215 |
Position | Head |
Organism | Dracunculus medinensis (Guinea worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Dracunculoidea> Dracunculidae> Dracunculus. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.855 |
Instability index | 43.15 |
Isoelectric point | 9.32 |
Molecular weight | 24226.34 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP05116 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 80.89| 18| 18| 150| 167| 1 --------------------------------------------------------------------------- 150- 167 (28.27/11.97) DDIDEEGKLVKRFKRSFE 170- 183 (24.62/ 9.64) DDVDSDRK....YKKHKG 184- 201 (28.00/11.80) DDSYKKQKKKKKDKKKKK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DRKYKKHKGDDSYKKQKKKKKDKKKKKDGKDEDLSKKSKKL 2) EPYRFFDKRMDDL | 175 131 | 215 143 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab