<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05093
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MDSIGNGVASSGSLRTKISLKGRYSQLSLVCPFHLMKPELPQQSVLLGSNDLLAEYDMGSSYQRFCGSKRLREDLGSFLPHLVGSFNFENALEFSSLRMLVEKPPITGKEITSLSAGAMAGFRLTPGAVPEPYRYFDNKVDDLSNDAMNYDENGEETKHKRKYKWSLDDLDDADLDRKYRKHRSEDKDRKKEKKKKKDKKRKRDSKEEDQNNKVRKM |
| Length | 217 |
| Position | Head |
| Organism | Brugia pahangi (Filarial nematode worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Brugia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -1.021 |
| Instability index | 40.89 |
| Isoelectric point | 9.29 |
| Molecular weight | 24921.95 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05093
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.03| 15| 15| 178| 192| 1
---------------------------------------------------------------------------
178- 192 (25.19/12.17) KYRKHRSEDKDRKKE
194- 208 (22.85/10.45) KKKKDKKRKRDSKEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.68| 13| 25| 134| 147| 2
---------------------------------------------------------------------------
134- 147 (19.75/14.54) RYFDNKVDDLsNDA
161- 173 (24.92/13.86) RKYKWSLDDL.DDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.94| 15| 16| 57| 71| 3
---------------------------------------------------------------------------
50- 68 (24.36/15.75) NDLlaeyDMGSSYQRFCGS
69- 85 (22.58/14.13) KRL..reDLGSFLPHLVGS
---------------------------------------------------------------------------
|