<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05088
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MTERYMPSIFPECDKLKQAYDKCFSDFFEKFISAETLTVSNPCDRLHETYRYCIEKVPYVLYCDGSWFVTKIISELKGKLMDPSLMGSMSNASILQETATDTRYNHLEQTLENFQENARQMGVIASDFTTRSQEPLNQKIHTLISGLHELDHLKNQFMDVKIPLELLEYLDQGKNPQLYTKECLERTLNKNKEMNGKIEMYKKFRAMLLKELGEEMPNDMVLYRNLRDRKDASPQHENCNEDASD |
| Length | 245 |
| Position | Middle |
| Organism | Brugia pahangi (Filarial nematode worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Brugia.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.685 |
| Instability index | 39.89 |
| Isoelectric point | 5.29 |
| Molecular weight | 28715.42 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05088
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.65| 13| 19| 161| 179| 1
---------------------------------------------------------------------------
147- 159 (23.36/ 7.18) LHELDHLKNQFMD
167- 179 (23.29/19.98) LEYLDQGKNPQLY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.33| 14| 19| 192| 205| 2
---------------------------------------------------------------------------
192- 205 (25.03/12.15) KEMNGKIEMYKKFR
214- 227 (25.31/12.34) EEMPNDMVLYRNLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.57| 11| 28| 13| 23| 3
---------------------------------------------------------------------------
13- 23 (22.43/14.73) CDKLKQAYDKC
43- 53 (24.15/16.35) CDRLHETYRYC
---------------------------------------------------------------------------
|