<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05077
| Description |
Mediator of RNA polymerase II transcription subunit 30 (Fragment) |
| Sequence | LLDMLEAFVANCTEHNGMEYTHMESLIPLKDEADNKTLDERRNTETYRQVLEENNILTEQVVSKNKQLKEVITNLRTIIWEINVMLTMRRS |
| Length | 91 |
| Position | Head |
| Organism | Papilio machaon (Old World swallowtail butterfly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Papilionidae> Papilioninae> Papilio.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.559 |
| Instability index | 56.34 |
| Isoelectric point | 4.98 |
| Molecular weight | 10767.18 |
| Publications | PubMed=26354079
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05077
No repeats found
No repeats found
|