<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05070
Description |
Mediator of RNA polymerase II transcription subunit 12-like protein |
Sequence | MICKALWINMEVIACEPLGCLVDQKGNKISGFDSDKKQGLRLTDKQRVSSWELVEGGRNPAPLSWAWFAATKIERKPLTYENAHRSVQRTK |
Length | 91 |
Position | Kinase |
Organism | Papilio xuthus (Asian swallowtail butterfly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Papilionidae> Papilioninae> Papilio.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.508 |
Instability index | 41.85 |
Isoelectric point | 9.37 |
Molecular weight | 10345.86 |
Publications | PubMed=26354079
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05070
No repeats found
No repeats found
|