<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05044

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMAFLDKQSLLFVDTADMLARMARETLVHARLPNFHIPAAVEVLTTGTYSRLPVCIRERIVPPDPITPAEKRSTLQRLNQVIQHRLVTGNLLPQMRNLKIEAGRVTFLVEQEFSVSLTVMGDGPTVPWRLLELEILVSDRETGDGKALVHPLQTRYVHQVVQSRLAESSNPLSEVYHILHYFCQSLQLEVLYSQTLRLIRDRLDDHIHVDEYTPGKCLSVSYWRELTNKDPRSELGYKLTVQVDQHDPARPLAIVHIPSLGNKESEIADRAIRSDQLSMECLLVHTIYVRTRSRLLDLKQELQTMLKDIECTLAGSPAILSVPILQPCLRAEHLLVTVDTHTGMLQCHVPQYEVPLIPELTTALNGDHSRLPTLISELRFWITQRRCEKTLQHLPATSHERLPVLLHPDHPMSKISRHRMFVQLHRHPTVILIVAFKEKETSPCEIECSFYLAVVKHSSIEDDPHDDSIETEIPKMYLKVQSLIEFDTFVITHGPFTSVDNEASEANNAKRRSTGPSGRSDASATLQNRRSKQPAYFIPELAHVVALCDERIPFVTLAQELTKRDIAHQGLQVEANATALVLKLVQLPAPSTGISTSCAWYALLKRLLSVSIRVQGKGMAKTWMAEFVFYGSPLSSSHPKEQGLRRPVYFQYEMGTADTVSRTVDALLNDWAQIVYLYSIVHDLAEYFKMEKYNLRNMISIKSYNYSKLVLIYGPNRGATVTVQWSTNDKAFKLIFGKSPTSTITNTHSIMKEQLEAHLNRHRNLAQLIHILHETLQPLTSISKLPTIPQLCVYNSRPQVPVQTFTIMPQCVTLVRIAYQGMYCLELRLRGSGLVSLRDGAYSRFDRSYVVDEFTPTQGLKAFLSKYVDESAVSRRRSQSEDDNPPSPVTMDSDGGSGSGNVGFLSHHRSGPQSPAQQRDGLRFHPPLTPPSGSNPHTPASPHTANISQTNQHQSFGSSPATSFNLASPPSLPPNTPNMLPHPSPGSGLVANSPLNPMHVPSPAGLMPTSSPGPCSNVPVGHSPAGSFMQTGHIDGSPFPSSQSMASPAASNWPGSPSVPRPSPVRPAQSPGYAALHSPQASDHKAGTHISRVLPQRSWAGAVPTLLTHEALELLCCPSPHPSGFPGPDLSPLERFLGCIYMRRQFQRFIQNDDCLTAVNSTEPGVVHFKVESLQCRVGLNPQHLQSLHIKVQPLPEHKDQWTLEELQIIEKFFDTRAAVPPYKPNTLSGFGRMLNVPFNVLKDFVQIMKLELVPGLAQQQQLKWNVQWCLRIPPSATPIVPTGMAAILVCRNKILFFLQITRIGLPYQGEIPSLVLPLVYDISTNLTQLAEKRDPSPASAMAAASLQLKRFAEYGANQSECSLFPAVRDLLANLTLPSEPPVMSQVVPSPAGGQVTPTQQIQSPAMQLHSPMAGSQGPPQAYGIQGMPPMGIMGGPPQ
Length1438
PositionTail
OrganismMelipona quadrifasciata
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Apoidea> Apidae> Melipona.
Aromaticity0.07
Grand average of hydropathy-0.229
Instability index63.00
Isoelectric point8.27
Molecular weight159498.23
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP05044
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             7|     482.52|      74|      78|     926|    1000|       1
---------------------------------------------------------------------------
  850-  925 (38.54/ 9.69)	VdE..FTP..TQGlkaflskyvdesavsrrrsqSE..........................D.......DNP.PSP..VTmdsdggsgsGNV..GFLSHHR...SGPQSPA.......................................................QQRDGLR....FHP..................
  926-  998 (137.41/53.01)	..P..LTP..PSG....................SN..........................P.......HTP.ASP..HT.........ANI..SQTNQHQ...SFGSSPA..T.....SFNLA.........SP...P........................SLPPNTPNML....PHPS..PGSGLVANSPLNPMH
 1000- 1076 (79.33/25.47)	PsPagLMP..TSS....................PG..........................PcsnvpvgHSP.AGSfmQT.........GHIdgSPFPSSQ...SM.ASPA..A.....S.NWP.........GS...P........................SVPRPSP.VR....PAQS..PG........YAALH
 1077- 1132 (44.88/12.41)	......................................................................SPqASD..HK.........A.......GTHI...S.RVLPQ..R.....SWAGA.........VP...T........................LLTHEALELLccpsPHPSgfPGPDL...SPL....
 1149- 1239 (59.00/18.46)	.....IQN..DDC....................LT..........................A.......VNS.TEP..GV.........VHF..KVESLQC...RVGLNPQhlQ.....SLHIK.........VQ...PlpehkdqwtleelqiiekffdtraAVPPYKPNTL..........SGFGRMLNVPFN...
 1274- 1379 (48.69/12.32)	P.S..ATPivPTG....................MAailvcrnkilfflqitriglpyqgeiP........SL.VLP..LV.........YDI..S.TNLTQlaeKRDPSPA..SamaaaSLQLKrfaeyganqSE...C........................SLFPAVRDLL................ANLTL.PSE
 1380- 1437 (74.69/25.19)	.......P..PVM....................SQ..........................V........VP..SP..AG.........GQV..TPTQQIQ.......SPA.........MQLH.........SPmagS........................QGPPQAYGIQ....GMP...P.MGIMGGPP.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      67.13|      14|      24|      47|      60|       2
---------------------------------------------------------------------------
   47-   60 (25.63/15.57)	TYSRLPVCIRERIV
   73-   86 (23.31/13.41)	TLQRLNQVIQHRLV
  389-  401 (18.19/ 8.61)	TLQHLPATSHERL.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.93|      23|      77|     322|     347|       3
---------------------------------------------------------------------------
  322-  347 (35.82/29.04)	PILqpcLRAEHLLVTVDTHTGMLQCH
  402-  424 (44.11/26.25)	PVL...LHPDHPMSKISRHRMFVQLH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     173.37|      43|      78|     681|     723|       5
---------------------------------------------------------------------------
  681-  723 (74.13/43.56)	HDLAEYFKMEKYNLRNMISIKSYNYSKLVLIYGPNRGATVTVQ
  727-  746 (32.39/14.90)	NDKA..FK.....................LIFGKSPTSTITNT
  762-  802 (66.84/38.55)	RNLAQLIHILHETLQPLTSISKLPTIPQLCVY..NSRPQVPVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.35|      16|      21|     107|     122|      10
---------------------------------------------------------------------------
  107-  122 (28.17/26.50)	LVEQEFSVSLTVMGDG
  129-  144 (27.17/25.21)	LLELEILVSDRETGDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.96|      12|     178|     349|     363|      11
---------------------------------------------------------------------------
  349-  363 (18.38/19.36)	PQYevpLIPELTT..AL
  533-  546 (19.58/10.05)	PAY...FIPELAHvvAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.63|      22|      22|     578|     599|      12
---------------------------------------------------------------------------
  578-  599 (37.07/23.87)	ALVLKLVQLPAPSTGISTSCAW
  601-  622 (35.56/22.58)	ALLKRLLSVSIRVQGKGMAKTW
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP05044 with Med14 domain of Kingdom Metazoa
Unable to open file!