<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05043
| Description |
Mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MAGQQHPFPSGFPSVQQSAMRTQFGGGQMVSGLMGPQQGSMVNPQQFGVGVGVGVGGVGSNTMAALVQQTNQGSNQATTPQTPVPPTQPPPPQQQQQQHNKEFNTASLCRFGQETVQDIVSRTLEVFQTLRVLQLPNGRITQLFLIIMTHLIILYNNYNI |
| Length | 160 |
| Position | Head |
| Organism | Melipona quadrifasciata |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Apoidea> Apidae>
Melipona.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.293 |
| Instability index | 52.37 |
| Isoelectric point | 9.18 |
| Molecular weight | 17302.45 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05043
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.25| 19| 20| 16| 35| 1
---------------------------------------------------------------------------
16- 35 (32.83/17.58) QQSAM..RTQFGGGQMVsGLMG
37- 57 (32.42/13.53) QQGSMvnPQQFGVGVGV.GVGG
---------------------------------------------------------------------------
|