<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05038
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNAPTTPPPNVPGAAPALAKITKNSSSPPVPAAIANKVGGAAAVAGNASPPQAPPQQPGAAPGRAVEGEDPNLPPAPDSPSTFASRQRELARDLIIKEQQIEYLISVLPGIGASEAEQETRIQDLETELRGVEKERAAKVRELKKLRTRLEDVLGAVAVGIHGDGYSQN |
| Length | 199 |
| Position | Middle |
| Organism | Penicillium nordicum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.374 |
| Instability index | 58.21 |
| Isoelectric point | 5.11 |
| Molecular weight | 20932.29 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05038
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.45| 19| 20| 70| 88| 1
---------------------------------------------------------------------------
44- 65 (23.12/ 7.41) AAPALAkitKNSSSPPVP.AAIA
70- 88 (37.01/15.53) GAAAVA...GNASPPQAP.PQQP
93- 110 (27.33/ 9.87) G.RAVE...GE.DPNLPPaPDSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.35| 19| 19| 128| 146| 2
---------------------------------------------------------------------------
128- 146 (31.06/21.75) EQQIEYLISVLPGIGASEA
149- 167 (30.29/21.06) ETRIQDLETELRGVEKERA
---------------------------------------------------------------------------
|