<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05031
Description |
Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MGDRLTQLQDAVDQLAQQFVACLHFVHKRHDLETLGPNDKVRDVKQEQSQKEVDPLPPDEFRAGLLELSRDLIIREQQIEMLISSLPGLDNSERDQERCIKELEDDLKAAEAQRQEALKEKDQILAELDSVIRSIRRP |
Length | 138 |
Position | Middle |
Organism | Escovopsis weberi |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Hypocreaceae> Escovopsis.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.746 |
Instability index | 57.27 |
Isoelectric point | 4.78 |
Molecular weight | 15935.79 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP05031
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.74| 12| 32| 67| 78| 1
---------------------------------------------------------------------------
67- 78 (20.28/ 9.57) ELSRDLIIREQQ
102- 113 (19.46/ 9.00) ELEDDLKAAEAQ
---------------------------------------------------------------------------
|