<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05028
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAHEMQAAPVTPTSASPSPPGGSPAAAATAAATTTEPPVADGRTPSMPVEERVRRDLEQRTRGVIDALYQLAARVADGRDDVPQSVADNVQHVVHAIAQIDAMRGHIHTQIPKDVMDLVDAGRNPDSYTRTFINRLASENQYSLGQYQSMRAFRDQLGVALSDAFPSLKPSIEKAQRP |
| Length | 178 |
| Position | Middle |
| Organism | Malassezia pachydermatis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Malasseziomycetes> Malasseziales> Malasseziaceae> Malassezia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.484 |
| Instability index | 50.15 |
| Isoelectric point | 5.92 |
| Molecular weight | 19179.22 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05028
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.40| 14| 16| 7| 20| 2
---------------------------------------------------------------------------
7- 20 (26.17/13.52) AAPVTPTSASPSPP
25- 38 (23.23/11.27) AAAATAAATTTEPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 91.17| 27| 27| 64| 90| 3
---------------------------------------------------------------------------
64- 90 (44.25/29.88) VIDALYQLAARVADGRDDVPQSVADNV
93- 119 (46.92/32.09) VVHAIAQIDAMRGHIHTQIPKDVMDLV
---------------------------------------------------------------------------
|