<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05018

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMENPAAAGDAMRAAIEYWCQFVARCVSERLETDKFEAYVKIVHDQHPLPPTLVADFFLRPQPSDDSSLDPRIPPYLQALTKLGYVDTPSILRALYKYSSSHAHAQAQKEHLQSNTEEGKGKEKEKGNQDDEGKVEEKEDAQPKKNITRWKNSYWAEEVLFYRLTKSVVEGRAIQDSRTALEVAMIISKFMELFTTALPATAFAADMLEQQFPSGQLRDEMESSRAALVALLLRLCENNILVSAISKPFAKNVRKALSTSLASFLPALQLVPEIADKLELFRIEILASSDPADKKKQVANAAMDELLDSTVGLENFVVAPISISNTRAGLYIYLNAALIGRPILDDHALFSCMSNKYGADIQSSAIDLILASFDILANAVFRNEGQKDAHLLRSFLINKLPLLLYQLLPPGFSGTSAEFCITEALTHVDTSLFPTASLMFDESRNNNPYTESIREEFCAACVLHGLVQREHVERILGEISLSYEPSLQKHSKDKLVQDCLSDTDKIQGLVRELDKTDGNVGAVCQALVEVLRQSCHNKETMSLKLLCSQLAAKPQSLDVILLFEKLPNILEPLCQLLDNWRYEEDQGEYQPVYEEFGAVLLLVFAFTYRYNLNAVDIGITTPDSWVAKIIARGHIGRQGNELTQRENEHINGWVHGLFDTEAGGLGDELMSSCPPQEFYLIVAPLFQSIVVAYTYGYLNDESLKGGIEYLVDTFLLPSLVPAIRFLADYLWIDQKEQKSIIKILQLILLPSSISGEASTMLSSVKNLIAKPLEHALRTYQRRDPKNQDIEPLLRTLKESIPLSRRTGGTDLNELESWTATPPSGLSSAVKLTIQGLVHWSIHPAMNSMPTSYTHRQILVGLKMLGPKRLLHVILEEVRQHTAAGSANIIYDVATSLICAPDAVKDAPVTGMLDANGNMLPPIQRPRSLRDLLKVEVESCRKLQKEDPVLAEHVVRLHRRVEAQMIIPQPQGMLQPADMSLNLADDTAALGDAMAAAASGAQGDGMSVDNLALDVSMGGVSSDMGLGSVTDGGNLDPSGDAEMFEGFDTQDMDNFEWSMNSF
Length1060
PositionTail
OrganismFusarium langsethiae
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium.
Aromaticity0.07
Grand average of hydropathy-0.141
Instability index44.57
Isoelectric point5.02
Molecular weight117350.69
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP05018
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      92.57|      30|      30|     687|     716|       1
---------------------------------------------------------------------------
  678-  694 (18.65/ 8.51)	..............YLIVAPLFQSIVVAYTY
  695-  724 (51.35/37.07)	GYL.NDESLKGGIEYLVDTFLLPSLVPAIRF
  727-  749 (22.57/11.93)	DYLwIDQKEQKSIIKILQLILLP........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.29|      21|     148|     494|     520|       2
---------------------------------------------------------------------------
  462-  498 (22.30/17.14)	LHGLVQreHVERILGEISlsyepslqkhskdkLVQDC
  505-  534 (28.99/ 9.86)	IQGLVR..ELDKTDGNVG.....avcqalvevLRQSC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.02|      16|      19|     765|     783|       3
---------------------------------------------------------------------------
  765-  783 (23.91/26.23)	NLIAKPLehaLRTYQRRDP
  785-  800 (28.12/19.66)	NQDIEPL...LRTLKESIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     135.33|      43|     134|     229|     271|       7
---------------------------------------------------------------------------
  229-  271 (69.62/47.57)	ALLLRLCENNILVSAISKPFAKNVRKALSTSLASFLPAL..QLVP
  364-  408 (65.71/44.46)	AIDLILASFDILANAVFRNEGQKDAHLLRSFLINKLPLLlyQLLP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP05018 with Med5 domain of Kingdom Fungi
Unable to open file!