<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05015
| Description |
Mediator-rna polymerase ii transcription subunit 21 |
| Sequence | MGDRLTQLQDAVDQLAQQFVACLHYVNKRHDLEILSPNDKIREVKDIPKEVDSLPPDEFRAGMVELSQDLIVKEQQIEVLISSLPGLDNSEMDQERYIKELEEDLKVAEAQRQEAIKEKDQILAELDGVIRSIRRP |
| Length | 136 |
| Position | Middle |
| Organism | Fusarium langsethiae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.582 |
| Instability index | 60.39 |
| Isoelectric point | 4.58 |
| Molecular weight | 15662.58 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP05015
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.28| 12| 34| 65| 76| 1
---------------------------------------------------------------------------
65- 76 (20.53/12.31) ELSQDLIVKEQQ
100- 111 (19.75/11.63) ELEEDLKVAEAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.61| 13| 36| 3| 15| 2
---------------------------------------------------------------------------
3- 15 (21.68/14.79) DRLTQLQD...AVDQL
39- 54 (15.93/ 9.09) DKIREVKDipkEVDSL
---------------------------------------------------------------------------
|