<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05010
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MMMGDQFRSKVEQYSPKSSPRGARSPVVSRQDSTGTLKTTISLGKNPSIVHSGPFYLMKEPPGESELTGATNLMTYYGLEHSYSKFSGKKLKEQLSSFLPNLPGIIDRPGHLDNSSLRSVIEKPPIGGKDLIPLTSVQLAGFRLHPGPLPEQYRYVNQAPQRKHKNKHKKHKHKPGEVLSGQEATTTDIEYSNYQQQGYNQYNQPPPSGGQDTSYPPPSSGGSGGYNQYSQPPPSSGSNYGSYNSYNSSSGQEYNQSQSQSSYQTYGSGGSGNSGSSNYNSSYGHGGGGGGGGGGSGGYSRNSSGGGYGGGGYGDRGGGNDGMVTQEDTIFVSGMDPSISEEEICQHFGAIGIIKHDKRTGKPKVWMYKDKNTGKSKGEATVTYDDQNAARSAIDWFDGKEFKGRTIKVQIAQHKSNWQGNRSGGSRGGGGRGRGSGGFGSRGGGGDRDDHHHRGGGSDDRRDGGSRGGDWRCPNPECGNTNFAWRDQCNLCKSLKPQGAGGSSGGGRGNRGGDRGGRGGFRSDRGGRGGDRGGRGGFRGGDRGGRGGRGGPMRGGGGRGDRDRDRQRPY |
| Length | 570 |
| Position | Head |
| Organism | Melipona quadrifasciata |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Apoidea> Apidae>
Melipona.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -1.187 |
| Instability index | 44.98 |
| Isoelectric point | 9.72 |
| Molecular weight | 60293.59 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | metal ion binding GO:0046872 IEA:UniProtKB-KW
RNA binding GO:0003723 IEA:UniProtKB-UniRule
transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP05010
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.66| 26| 26| 511| 536| 1
---------------------------------------------------------------------------
223- 252 (36.30/ 6.31) SGGYNQYSQPPPSSGSNYGSYNsynsSSGQ
515- 542 (50.36/12.37) RGGRGGFRSDRGGRGGDRGGRG..gfRGGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 253.20| 79| 113| 343| 454| 3
---------------------------------------------------------------------------
360- 454 (121.01/66.19) TGKPkvwmyKDKNTGKSKGeATVTYDDQNAARSAIDWFDGKEFkGRTIKVQIAqhksnwqGNRSGGSRG..GG...............................GRGrGSGGfGSRGGG..GDRDDHHHR
455- 568 (132.19/32.73) GGGS.....DDRRDGGSRG.GDWRCPNPECGNTNFAWRDQCNL.CKSLKPQGA.......GGSSGGGRGnrGGdrggrggfrsdrggrggdrggrggfrggdrgGRG.GRGG.PMRGGGgrGDRDRDRQR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.42| 19| 49| 255| 273| 7
---------------------------------------------------------------------------
255- 273 (35.81/12.40) NQSQSQSSY..QTYGSGGSGN
300- 320 (32.61/10.51) SRNSSGGGYggGGYGDRGGGN
---------------------------------------------------------------------------
|