<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05005

Description Mediator of RNA polymerase II transcription subunit 28
SequenceMEAFFLQKRFLLSALKPELVVKEDINDLRVELARKEDLIKRHYDKITVWQNLLADLQGWAKSPAQGPAPNGLPNGTQSGQNQQSANGGGNATMQQQQQILQHQQQMQQQQQQLQHLQQHQMQQQQLHQQQNICDVKLQVQQGSGAPPTSGLQGVGVSVGQQGMFMTQGGVGVTGTRGGFPVAGVGSSALQGPLAFLEKTTSNIGMPERRS
Length210
PositionHead
OrganismMelipona quadrifasciata
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Apoidea> Apidae> Melipona.
Aromaticity0.04
Grand average of hydropathy-0.635
Instability index69.74
Isoelectric point9.21
Molecular weight22926.58
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP05005
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.93|      17|      18|      94|     111|       1
---------------------------------------------------------------------------
   94-  111 (28.50/13.37)	QQ.QQQILQhQQQMQQQQQ
  114-  131 (29.43/ 9.98)	QHlQQHQMQ.QQQLHQQQN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.04|      11|      15|     144|     156|       2
---------------------------------------------------------------------------
  144-  156 (18.66/11.68)	GAPPTSGlqGVGV
  162-  172 (23.38/ 9.77)	GMFMTQG..GVGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.72|      16|      18|      61|      76|       3
---------------------------------------------------------------------------
   56-   71 (29.31/14.47)	LQGWAKSPAQGPAPNG
   72-   87 (28.41/13.80)	LPNGTQSGQNQQSANG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP05005 with Med28 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) WAKSPAQGPAPNGLPNGTQSGQNQQSANGGGNATMQQQQQILQHQQQMQQQQQQLQHLQQHQMQQQQ
59
125










Molecular Recognition Features






MoRF SequenceStartStop




NANANA