<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP05003
Description |
Mediator of RNA polymerase II transcription subunit 27 |
Sequence | MEQLQTALTAIKVLRSSVGQVFDSLGNGLRADHGEENKENKYLLELQELLTTVNVNLRDVEQAVNSLNPPPGPFNLASTTYLSQETTQERQALYSTLVNSYKWTDKVHEYSNVAQALLSQNSLKRSYNTTSRAKRGRIQTSTHNVPQQQVDTLIATFDRLFNDMTVSVSRPFASNAVLHVTLGHVLKGVIAFKGLMIEWVVVKGYGETMDLWTESRHKVFRKVTENAHAAMLHFYSPTLPELAVRSFMTWFHSLNNLFSDPCKRCGLHLHSALPPTWRDFRTLESYHQECKPKQIGDYLICVQANAKEDLPMVSVYSLGPMKSLRKQNFKSCLFYNKEVALETA |
Length | 344 |
Position | Tail |
Organism | Melipona quadrifasciata |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Apoidea> Apidae>
Melipona.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.345 |
Instability index | 40.86 |
Isoelectric point | 8.83 |
Molecular weight | 39059.09 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP05003
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.87| 20| 26| 242| 262| 1
---------------------------------------------------------------------------
242- 262 (35.40/23.92) LAVRSFM..TW..FHSLNNlFSDPC
267- 290 (29.47/15.40) LHLHSALppTWrdFRTLES.YHQEC
---------------------------------------------------------------------------
|