<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04995
| Description |
Uncharacterized protein |
| Sequence | MDPDSDYPPSDLSSPSSEDNKKDPPTMDSRPTAKELLDRVDYDISQLLQRFENIVAIAANKFDGTSHVDAAVEAFQIDVESTALIRAAEDLLALHRLMKELWLFGKLDTLGEDERDVKRREKLEEDVEAIQKALDGGLLMPSSDEPGTSDKSEDTEKGKGPEQSDKPEQSEK |
| Length | 172 |
| Position | Head |
| Organism | Penicillium nordicum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.875 |
| Instability index | 60.40 |
| Isoelectric point | 4.37 |
| Molecular weight | 19132.84 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04995
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.94| 13| 14| 2| 15| 1
---------------------------------------------------------------------------
2- 15 (21.60/13.98) DPDSDyPPSDLSSP
19- 31 (26.34/12.43) DNKKD.PPTMDSRP
---------------------------------------------------------------------------
|