Description | Uncharacterized protein |
Sequence | MDPDSDYPPSDLSSPSSEDNKKDPPTMDSRPTAKELLDRVDYDISQLLQRFENIVAIAANKFDGTSHVDAAVEAFQIDVESTALIRAAEDLLALHRLMKELWLFGKLDTLGEDERDVKRREKLEEDVEAIQKALDGGLLMPSSDEPGTSDKSEDTEKGKGPEQSDKPEQSEK |
Length | 172 |
Position | Head |
Organism | Penicillium nordicum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.875 |
Instability index | 60.40 |
Isoelectric point | 4.37 |
Molecular weight | 19132.84 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04995 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.94| 13| 14| 2| 15| 1 --------------------------------------------------------------------------- 2- 15 (21.60/13.98) DPDSDyPPSDLSSP 19- 31 (26.34/12.43) DNKKD.PPTMDSRP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EQSEK 2) SDYPPSDLS | 168 5 | 172 13 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab