Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDRTHLTSFQARPPSPSSPAGSLKENHRLPISSEHIPQTPTSPPLMSVNEQSHAANFTSSHTSPNQATVQPPNISSPPSSAPMSTQVSQQPTMSTTNSLPTPASSVSSHPANATSEDVDQGRKSFNMGIQDSAENSGAAPAQRQTQQQTQHRPTDHDRQSLQTESTNEFANGQGQHSTDPDAMDVDTEPTRRADTLSLDFDSLQKELTSAFHLCKSSPIVTGPDPSVDLVSLYGLGSIAHSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPHKQEIGAPGSLRYMTLWPEEEWQNQKVHGKAIKVSDMDSALQNLQSRAMQMEPGPIPNNDWWEDILGHEKQAKNPAPGETSKKAAPAPTAGRPSMQSYAASPRSQEAERPRPSRGRKRNYDDNSFAGYGEGFVDDDDDPGFYSNGEGSGKKKRKKVSTPMSERSASYGVGMFGIGAR |
Length | 453 |
Position | Head |
Organism | Penicillium nordicum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.966 |
Instability index | 58.66 |
Isoelectric point | 6.55 |
Molecular weight | 49019.26 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04986 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 97.20| 21| 21| 60| 80| 1 --------------------------------------------------------------------------- 6- 22 (25.40/10.43) ..HLTSFQA..RPPSPS.SPAG 34- 53 (30.71/14.30) SEHI.P.QTPTSPPLMSvNEQS 60- 80 (41.09/21.88) SSHTSPNQATVQPPNIS.SPPS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 85.73| 20| 21| 152| 172| 2 --------------------------------------------------------------------------- 152- 169 (28.40/18.10) ......HRPTDHDRQSLQTESTNE 171- 193 (28.78/21.32) ANgqgqH.STDPDAMDVDTEPTRR 194- 211 (28.55/14.48) AD....TLSLDFD..SLQKELTSA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 59.78| 17| 21| 352| 368| 3 --------------------------------------------------------------------------- 352- 368 (29.32/11.53) APGETSKKAAPAPTAGR 376- 392 (30.45/12.21) ASPRSQEAERPRPSRGR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.40| 19| 21| 88| 106| 4 --------------------------------------------------------------------------- 93- 111 (31.66/15.87) TMSTTNSLPTPASS..VSSHP 112- 132 (21.74/ 8.72) ANATSEDVDQGRKSfnMGIQD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 68.20| 20| 20| 263| 282| 5 --------------------------------------------------------------------------- 263- 282 (34.32/19.72) GKLKGLGLAGRNKPHKQEI.G 285- 305 (33.88/19.38) GSLRYMTLWPEEEWQNQKVhG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.83| 11| 14| 397| 407| 7 --------------------------------------------------------------------------- 397- 407 (22.39/13.84) DDNSFAGYGEG 413- 423 (23.44/14.81) DDPGFYSNGEG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DWWEDILGHE 2) GYGEGFVDDDDDPGFYSNGEGSGKKKRKKVSTPMSERSASYGVGMFG | 336 403 | 345 449 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab