<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04986
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRTHLTSFQARPPSPSSPAGSLKENHRLPISSEHIPQTPTSPPLMSVNEQSHAANFTSSHTSPNQATVQPPNISSPPSSAPMSTQVSQQPTMSTTNSLPTPASSVSSHPANATSEDVDQGRKSFNMGIQDSAENSGAAPAQRQTQQQTQHRPTDHDRQSLQTESTNEFANGQGQHSTDPDAMDVDTEPTRRADTLSLDFDSLQKELTSAFHLCKSSPIVTGPDPSVDLVSLYGLGSIAHSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPHKQEIGAPGSLRYMTLWPEEEWQNQKVHGKAIKVSDMDSALQNLQSRAMQMEPGPIPNNDWWEDILGHEKQAKNPAPGETSKKAAPAPTAGRPSMQSYAASPRSQEAERPRPSRGRKRNYDDNSFAGYGEGFVDDDDDPGFYSNGEGSGKKKRKKVSTPMSERSASYGVGMFGIGAR |
| Length | 453 |
| Position | Head |
| Organism | Penicillium nordicum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.966 |
| Instability index | 58.66 |
| Isoelectric point | 6.55 |
| Molecular weight | 49019.26 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04986
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 97.20| 21| 21| 60| 80| 1
---------------------------------------------------------------------------
6- 22 (25.40/10.43) ..HLTSFQA..RPPSPS.SPAG
34- 53 (30.71/14.30) SEHI.P.QTPTSPPLMSvNEQS
60- 80 (41.09/21.88) SSHTSPNQATVQPPNIS.SPPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 85.73| 20| 21| 152| 172| 2
---------------------------------------------------------------------------
152- 169 (28.40/18.10) ......HRPTDHDRQSLQTESTNE
171- 193 (28.78/21.32) ANgqgqH.STDPDAMDVDTEPTRR
194- 211 (28.55/14.48) AD....TLSLDFD..SLQKELTSA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.78| 17| 21| 352| 368| 3
---------------------------------------------------------------------------
352- 368 (29.32/11.53) APGETSKKAAPAPTAGR
376- 392 (30.45/12.21) ASPRSQEAERPRPSRGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.40| 19| 21| 88| 106| 4
---------------------------------------------------------------------------
93- 111 (31.66/15.87) TMSTTNSLPTPASS..VSSHP
112- 132 (21.74/ 8.72) ANATSEDVDQGRKSfnMGIQD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.20| 20| 20| 263| 282| 5
---------------------------------------------------------------------------
263- 282 (34.32/19.72) GKLKGLGLAGRNKPHKQEI.G
285- 305 (33.88/19.38) GSLRYMTLWPEEEWQNQKVhG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.83| 11| 14| 397| 407| 7
---------------------------------------------------------------------------
397- 407 (22.39/13.84) DDNSFAGYGEG
413- 423 (23.44/14.81) DDPGFYSNGEG
---------------------------------------------------------------------------
|