Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MSSLNLDDDELKAVEQTLARLLQLSNSIQSLKTDILKSNPLPPPSSLQASAQILQRNLQTVLDNLSENQELFSRIAVHPSTNYPGRTQEGVLTQLLRKKLEPDVEELVLKGRESARLATPEGLEKLQDIWQELREWTQERIARYVREEASDVYTQEERAMGVENVRTGLRKDLEEESDEEEGDDEGDDDDDDDDAADGNEDEFGQAKQPAVRGPEPETLLWFAARGDFNVPNSIEFERKVGVKRGLEGVRLPPATMDEMGSL |
Length | 262 |
Position | Head |
Organism | Escovopsis weberi |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Escovopsis. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.818 |
Instability index | 49.60 |
Isoelectric point | 4.35 |
Molecular weight | 29486.14 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04983 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 174.25| 62| 71| 36| 106| 1 --------------------------------------------------------------------------- 36- 106 (91.44/74.80) LK...SNPLPPPSSLQasaqilqRnLQTVLDNLSE.NQELFSR.IAVHPSTNYPGRTQ....EGVLTQlLRKKLEPDVEE 109- 179 (82.81/48.58) LKgreSARLATPEGLE.......K.LQDIWQELREwTQERIARyVREEASDVYTQEERamgvENVRTG.LRKDLEEESDE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GNEDEFGQAKQ 2) LKTDIL 3) RGPEPETLLWFAAR | 198 31 212 | 208 36 225 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab