Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MYEVFLTALVEDRDIIAAKAVLSGYCSMQPWESTHRVLYYQGPSRPSGINNQSSLEKPMRKDNVWLWKELHQNFARQSFILQARYEILRDTDLGTTAAIPMHLDSTPGVLRWTDFPDPPRGQPFLTQRKKVEIWEQRKLPSVLRDNKHQ |
Length | 149 |
Position | Head |
Organism | Escovopsis weberi |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Escovopsis. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.631 |
Instability index | 49.24 |
Isoelectric point | 9.10 |
Molecular weight | 17438.71 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP04981 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) FLTQRKKVEIWEQRKLPSVLR 2) HRVLYY | 124 35 | 144 40 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab