<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04978
Description |
Mediator of RNA polymerase II transcription subunit 13 |
Sequence | MNQQEMDFWVDLARTEINAAVTMILMTVDTNPSLQLLPPIMKLPGSATMVCSTPVSTSQTSAVSPEQMTASTASSIRDSNTAITLPTDAPAADADADAALADISDQTWGAIANHRLSNSASLLEVRPALISGYLVKRTGMRVEDAPVVMEVNMVHTDQVPRAYEPLLREMLSHFRGLGTLARARGVVDRETDVRPWHVAAAEKAVRALYLLM |
Length | 212 |
Position | Kinase |
Organism | Escovopsis weberi |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Hypocreaceae> Escovopsis.
|
Aromaticity | 0.04 |
Grand average of hydropathy | 0.008 |
Instability index | 26.30 |
Isoelectric point | 5.03 |
Molecular weight | 22944.03 |
Publications | |
Function
Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
ECO:0000256 RuleBase:RU364134
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP04978
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.05| 20| 40| 15| 34| 2
---------------------------------------------------------------------------
15- 34 (33.43/21.91) TEINAAVTMILMTVDTNPSL
57- 76 (32.63/21.23) TSQTSAVSPEQMTASTASSI
---------------------------------------------------------------------------
|