<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04973
Description |
Mediator of RNA polymerase II transcription subunit 14 |
Sequence | MSTVSAEGAMPAMEVLLQELPLEDNGLVSLGVLAERLSNSAYQTIQSLGDTLPSLSSNAKRAKIYATAIELRKIFIKLLVLVRWSKDADLLNRARNVVGLLVEQQWAHEDVFSGLTQVRKILPNARMCDADLVTAIDVLRSGTYERLPLSIKDSTIPAKPLSDAEALAVLHDLDEILSVRLACSETIPLGMKLKNIEDGKAYFEAKGLYNWAKF |
Length | 214 |
Position | Tail |
Organism | Malassezia pachydermatis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Malasseziomycetes> Malasseziales> Malasseziaceae> Malassezia.
|
Aromaticity | 0.06 |
Grand average of hydropathy | 0.081 |
Instability index | 41.87 |
Isoelectric point | 5.52 |
Molecular weight | 23552.05 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU365082
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP04973
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 92.05| 31| 39| 137| 167| 1
---------------------------------------------------------------------------
137- 167 (50.62/28.76) DVL..RSGTYERLPLSIKDSTI.PAKPLSDAEAL
175- 208 (41.43/22.59) EILsvRLACSETIPLGMKLKNIeDGKAYFEAKGL
---------------------------------------------------------------------------
|