<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04963

Description MED25
SequenceMEVDQPTLADVVFVIESSAINGAYINELKTNYILPTLEHFTQGAIDEREYLIAERHATLYGIVTYRTASNLLEPVCATYGPFVQPQKVIDTIERLPLVGGGMESHAHMAEGFATAHSCFDDINEQRHMLDQSQLQRHCILICNSPPYQMCVNENWKYNGKSCEQLAVLFMERKINFSIIAPRKMPVLFKLYMKADGDQPITTNNYAKNIRHLVLLKGYSLNERAPSAVGGGNGPGGMPMQPQMQMNMMQQQQQQQQQQRMPLGVPGANPNLQQQLQQQQQQRMMRPMMANNNPGLRQLLQHQAASPGNQFRPQMGGQPNQMGAGGPMVGNRNFDDGGYEFMQ
Length342
PositionUnknown
OrganismDrosophila busckii (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila.
Aromaticity0.07
Grand average of hydropathy-0.515
Instability index47.20
Isoelectric point6.50
Molecular weight38442.54
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP04963
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.58|      20|      21|     249|     269|       1
---------------------------------------------------------------------------
  249-  269 (38.10/19.18)	QQQQQQQQQQRM..PLgVPGANP
  272-  293 (36.48/14.72)	QQQLQQQQQQRMmrPM.MANNNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.45|      14|      70|     234|     248|       2
---------------------------------------------------------------------------
  234-  248 (27.27/13.63)	PGGMpMQPQM..QMNMM
  306-  321 (26.18/ 8.91)	PGNQ.FRPQMggQPNQM
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP04963 with Med25 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) APSAVGGGNGPGGMPMQPQMQMNMMQQQQQQQQQQRMPLGVPGANPNLQQQLQQQQQQRMMRPMMANNNPGLRQLLQHQAASPGNQFRPQMGGQPNQMGAGGPMVGNRNFDDGGYEFMQ
224
342










Molecular Recognition Features






MoRF SequenceStartStop




NANANA