<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04950
| Description |
MED28 |
| Sequence | MSTPSNEAGGGNLMDEFEEAFQACLLSLTKQEPNSGTNKEEIELEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKAGLADNQQGMGVHNRPAPPNMQPMPGPGPRPGMMGGMPPGGMPPGQQHLMQAQQMQQLRMMGKLPHK |
| Length | 176 |
| Position | Head |
| Organism | Drosophila busckii (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.764 |
| Instability index | 66.09 |
| Isoelectric point | 6.43 |
| Molecular weight | 19844.66 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP04950
No repeats found
|