<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04941
Description |
Mediator of RNA polymerase II transcription subunit 31 (Fragment) |
Sequence | IESEEQQKRRWQIELEFVQCLSNPNYLNFLAQRGYFKDASFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLLQYEHFRREIVNNQCCKFIDDQAILQWQHYTRKRIKLINSVQENAAAAAAAQNGPSEAATAPGSEAANPQQAALQNGNAEMNGIASS |
Length | 158 |
Position | Middle |
Organism | Drosophila busckii (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila.
|
Aromaticity | 0.13 |
Grand average of hydropathy | -0.563 |
Instability index | 52.54 |
Isoelectric point | 5.72 |
Molecular weight | 18347.44 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP04941
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 93.01| 21| 21| 60| 80| 1
---------------------------------------------------------------------------
41- 53 (17.15/ 6.57) ........FIN...YLKYLQYWKE
60- 80 (40.19/22.98) LMYPMCLYFLD...LLQYEHFRRE
81- 104 (35.67/19.76) IVNNQCCKFIDdqaILQWQHYTRK
---------------------------------------------------------------------------
|