<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP04935
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | KLTENKLYDIDIEELRKTVLNTERDRLKEQQQQKLFLGNMGAVPMIHENAAEARFNQLEQTLENFQENARQMGVIASDFTTRSQDPLNQKIHTLISGLRELDHLKNQFMDVKIPLELLDYLDQGKNPQLYTKECLERTLNKNKEVNGKIEIYKKFRAVLLKELGEELPNDTVL |
| Length | 173 |
| Position | Middle |
| Organism | Anisakis simplex (Herring worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Ascaridomorpha> Ascaridoidea> Anisakidae> Anisakis>
Anisakis simplex complex.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.727 |
| Instability index | 36.42 |
| Isoelectric point | 5.53 |
| Molecular weight | 20225.86 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP04935
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.75| 25| 26| 21| 46| 1
---------------------------------------------------------------------------
21- 46 (39.41/31.19) NTERDRLkEQQQQKL..FLGNMGAVPMI
49- 75 (37.34/24.46) NAAEARF.NQLEQTLenFQENARQMGVI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.71| 16| 18| 101| 116| 2
---------------------------------------------------------------------------
101- 116 (29.64/21.91) LDHL...KNQFMDVKIPLE
118- 136 (25.07/17.49) LDYLdqgKNPQLYTKECLE
---------------------------------------------------------------------------
|